CAT# | AF2591 |
Sequence | GIFSLIKGAAKVVAKGLGKEVGKFGLDLMACKVTNQC |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...
Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...