Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Online Inquiry
| CAT# | X21196 |
| M.W/Mr. | 5797.5 |
| Sequence | One Letter Code: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
Three Letter Code: H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH (Disulfide bridge:C23-29) |
| Storage | -20°C |
References | 1. Houben, R. et al. Biochem J 364, 323 (2002);
2. Ducy, P. et al. Nature 382, 448 (1996);
3. Benton, ME. et al. Biochem 37, 13262 (1995);
4. Engelke, J. et al. Biochim Biophys Acta 1078, 31 (1991);
5. Ulrich, M. et al. Biochim Biophys Acta 830, 105 (1985). |
Write a review
Ask a question
My Review for Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
Required fields are marked with *
×
Ask a Question for Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
