CAT# | AF1974 |
Sequence | SLGSFMKGVGKGLATVGKIVADQFGKLLEA |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Etomidate, a highly selective intravenous anesthetic agent, was first synthesized at Janssen Pharmaceuticals in ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...