CAT# | C0044 |
CAS | 255721-52-9 |
M.F/Formula | C₁₈₀H₂₈₂N₅₆O₅₆S₂ |
M.W/Mr. | 4190.69 |
Sequence | EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...
PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...