CAT# | AF3171 |
Sequence | RTCESPSNKFQGVCLNSQSCAKACPSEGFSGGRCSSLRCYCSKAC |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...
Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...
Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...
An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...
Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...