[Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT
[Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT
Online Inquiry
| CAT# | S06002 |
| M.W/Mr. | 3376.9 |
| Sequence | CMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Write a review
Ask a question
My Review for [Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT
Required fields are marked with *
×
Ask a Question for [Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
