[Cys1] Inter-alpha-Trypsin Inhibitor Heavy Chain 4, ITIH4 (657-687), C-terminal fragment 1, H4CT

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	S06002
M.W/Mr.	3376.9
Sequence	CMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF

CAT#	Product Name	Inquiry
X19460	UP_P80774	Inquiry
X01336	PH1PO005_09	Inquiry
X19528	UP_P80853	Inquiry
X18535	UP_P21586	Inquiry
X06789	PM_15183041	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Ornipressin: a synthetic derivative of vasopressin

Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...

ADWX-1-A Potent Peptide Inhibitor for Kv1.3 Channel

The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...

Function of mambalgin 1 in inhibiting acid-sensing ion channels

Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...

Difopein, a high affinity inhibitor of 14-3-3 proteins

The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...

Pentagastrin functions as diagnostic aids

Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: