CAT# | AF1962 |
Sequence | KIPCGESCVWIPCVTSIFNCKCENKVCYHD |
Activity | Antiviral |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...
st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...