CC Chemokine Receptor 3 Fragment I, amide
CC Chemokine Receptor 3 Fragment I, amide
Online Inquiry
| CAT# | S06011 |
| M.F/Formula | Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt |
| M.W/Mr. | 3332.6 |
| Sequence | MTTSLDTVETFGTTSYYDDVGLLCEKADTR-NH2 |
Write a review
Ask a question
My Review for CC Chemokine Receptor 3 Fragment I, amide
Required fields are marked with *
×
Ask a Question for CC Chemokine Receptor 3 Fragment I, amide
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
