CAT# | C06012 |
M.W/Mr. | 3604.1 |
Sequence | CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...