Brain Natriuretic Peptide, Human

Brain natriuretic peptide, uretic peptide or Ventricular Natriuretic Peptide (still BNP), is a 32-amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes). BNP is named as such because it was originally identified in extracts of porcine brain, although in humans it is produced mainly in the cardiac ventricles.

Online Inquiry

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	10-101-25
CAS	124584-08-3 (net)
Background	BNP was primarily discovered in porcine brain, but the highest concentration of peptide is found in the heart. It is a 32 amino-acid peptide, synthesized within the ventricles in response to myocyte stretch and/or pressure overload. It is released both as an active hormone and an inactive N-terminal fragment (NT pro-BNP).
Synonyms/Alias	Natriuretic Peptide, Brain; BNP-32; Natrecor; BNP; B-Type Natriuretic Peptide; BNP32; BNP 32; Nesiritide; Type-B Natriuretic Peptide
M.F/Formula	C143H244N50O42S4
M.W/Mr.	3464.09
Sequence	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Modifications: Disulfide bridge between 10 - 26)
Labeling Target	Atrial natriuretic peptide receptor
Application	Brain natriuretic peptide (BNP) decreases the systemic vascular resistance and central venous pressure as well as increases the natriuresis. Thus, the net effect of BNP and atrial natriuretic peptide (ANP) is a decrease in blood volume, which lowers systemic blood pressure and afterload, yielding an increase in cardiac output, partly due to a higher ejection fraction.
Areas of Interest	Cardiovascular Disease
Functions	Protein kinase activity

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-03	Angiotensin II Acetate	1106.2	C52H75N13O14	Inquiry
10-101-53	Eledoisin	1188.4	C54H85N13O15S	Inquiry
10-101-55	Rotigaptide	617.65	C28H39N7O9	Inquiry
10-101-70	Argipressin	1084.21	C46H65N15O12S2	Inquiry
10-101-82	Endothelin-1 (human, bovine, dog, mouse, porcine, rat) Acetate	2491.94	C109H159N25O32S5	Inquiry
10-101-90	Lepirudin	6979.52	C287H440N80O111S6	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Source#	Synthetic
Long-term Storage Conditions	−20°C
Organism	Human
BoilingPoint	N/A
References	Higher BNP concentrations early after first myocardial infarction are associated with adverse left ventricular remodelling characteristics. This may help explain why BNP is such a strong predictor of outcome after myocardial infarction. Crilley J G, Farrer M. Left ventricular remodelling and brain natriuretic peptide after first myocardial infarction[J]. Heart, 2001, 86(6): 638-642. Subtle cardiac abnormalities have been described in patients with cirrhosis. Natriuretic peptide hormones have been reported to be sensitive markers of early cardiac disease. We postulate that plasma levels of N-terminal pro-atrial natriuretic peptide and brain natriuretic peptide could be used as markers of cardiac dysfunction in cirrhosis. Florence W, Samuel S I U, Peter L I U, et al. Brain natriuretic peptide: is it a predictor of cardiomyopathy in cirrhosis?[J]. Clinical Science, 2001, 101(6): 621-628.
Melting Point	N/A