CAT# | B1804 |
CAS | 117345-87-6 |
M.F/Formula | C₁₄₉H₂₅₀N₅₂O₄₄S₃ |
M.W/Mr. | 3570.15 |
Sequence | One Letter Code: SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY three Letter Code: H-Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr-OH trifluoroacetate salt (Disulfide bond) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...
Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...