CAT# | A13212 |
M.W/Mr. | 3462.0 |
Sequence | SGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...
Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...