CAT# | AF2553 |
Sequence | WNPFKELERAGQRVRDAVISAAAVATVGQAAAIARG |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...