CAT# | R1077 |
CAS | 252642-12-9 |
M.F/Formula | C184H297N69O43S |
M.W/Mr. | 4195.87 |
Sequence | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...
Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...
The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...