β-Amyloid (1-42), rat TFA
β-Amyloid (1-42), rat TFA
β-Amyloid (1-42), rat TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
Online Inquiry
| CAT# | R1767 |
| M.F/Formula | C₁₉₉H₃₀₇N₅₃O₅₉S.C₂HF₃O₂ |
| M.W/Mr. | 4532.04 |
| Sequence | One Letter Code: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
three Letter Code: Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
Write a review
Ask a question
My Review for β-Amyloid (1-42), rat TFA
Required fields are marked with *
×
Ask a Question for β-Amyloid (1-42), rat TFA
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
