Keywords Search Google Search Search

2 X tandem repeats of SVP-1 like motif

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	S15012
Sequence	VKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTK

CAT#	Product Name	Inquiry
X08450	PM_1688524	Inquiry
P6503	pp60 c-src (521-533) (phosphorylated)	Inquiry
X13071	PM_7513024	Inquiry
X15461	PM_8841552	Inquiry
X03775	PM_11068091	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Amyloid Precursor Protein and Alzheimer's Disease

The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...

The Function of Dipeptide-4 in Human Skin

An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...

Progress of Clinical Research on Trofinetide

Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...

Function of elcatonin in treatment of osteoporosis

Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...

Function of ICI 174,864 in traumatic hemorrhagic shock

ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: