Keywords Search Google Search Search

2 X tandem repeats of SVP-1 like motif

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	S15012
Sequence	VKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTK

CAT#	Product Name	Inquiry
X20458	UP_Q0VTU0	Inquiry
X06783	PM_15175421	Inquiry
X06275	PM_14571980	Inquiry
X03499	PM_10904866	Inquiry
X05126	PM_12182954	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

Effects of L-NMMA Acetate in DOCA-salt Hypertension

NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...

A new kind of glycopeptide antibiotics–Ramoplanin

Ramoplanin is a new kind of glycopeptide antibiotics, which can inhibit the biosynthesis of the cell walls of gr ...

Progress of Clinical Research on Trofinetide

Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...

Ziconotide: Use in the treatment of pain

Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: