CAT# | AF2038 |
Sequence | GTFPCGESCVWIPCISKVIGCACKSKVCYKN |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...
Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...