CAT# | V05002 |
M.F/Formula | C147H238N44O42S |
M.W/Mr. | 3325.7 |
Sequence | SDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...