CAT# | U02006 |
M.F/Formula | C186H311N51O53S2 |
M.W/Mr. | 4174.0 |
Sequence | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...
GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...