CAT# | P03033 |
M.F/Formula | C189H296N58O50 |
M.W/Mr. | 4180.79 |
Sequence | YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
Etomidate, a highly selective intravenous anesthetic agent, was first synthesized at Janssen Pharmaceuticals in ...
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...
Trifluoroacetyl tripeptide-2 (TFA-T2) is an innovative peptide compound that has garnered significant attention in dermatolog ...