[Tyr0] Calcitonin Gene Related Peptide, human
[Tyr0] Calcitonin Gene Related Peptide, human
Online Inquiry
| CAT# | C05043 |
| CAS | 124756-98-5 |
| Synonyms/Alias | Tyr-CGRP I (human) |
| M.F/Formula | C172H276N52O51S2 |
| M.W/Mr. | 3952.6 |
| Sequence | One Letter Code: YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Cys3 and 8 bridge)
three Letter Code: H-Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (trifluoroacetate salt)(Cys3 and 8 bridge) |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for [Tyr0] Calcitonin Gene Related Peptide, human
Required fields are marked with *
×
Ask a Question for [Tyr0] Calcitonin Gene Related Peptide, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
