[Tyr0] BNP (1-32), human
Online Inquiry
| CAT# | B1801 |
| CAS | 1815617-97-0 |
| M.F/Formula | C152H253N51O44S4 |
| M.W/Mr. | 3627.3 |
| Sequence | One Letter Code: YSPKMVQGSGCFGRKMDRLSSSSGLGCKVLRRH (Cys11 and 27 bridge)
three Letter Code: H-Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Leu-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for [Tyr0] BNP (1-32), human
Required fields are marked with *
×
Ask a Question for [Tyr0] BNP (1-32), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
