CAT# | T25003 |
Sequence | SLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...