TIP 39, Tuberoinfundibular Neuropeptide
TIP 39, Tuberoinfundibular Neuropeptide
TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R).
Online Inquiry
| CAT# | R1720 |
| CAS | 277302-47-3 |
| M.F/Formula | C₂₀₂H₃₂₅N₆₁O₅₄S |
| M.W/Mr. | 4504.20 |
| Sequence | One Letter Code: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
three Letter Code: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for TIP 39, Tuberoinfundibular Neuropeptide
Required fields are marked with *
×
Ask a Question for TIP 39, Tuberoinfundibular Neuropeptide
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
