Keywords Search Google Search Search

Syntide 2

Syntide 2 is recognized as a substrate by Ca2+/calmodulin-dependent protein kinase II (CaMKII) with a Ki of 12 μM.

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1699
CAS	108334-68-5
Synonyms/Alias	Calmodulin-Dependent Protein Kinase Substrate
M.F/Formula	C68H122N20O18
M.W/Mr.	1507.84
Sequence	One Letter Code: PLARTLSVAGLPGKK Three Letter Code: Pro-Leu-Ala-Arg-Thr-Leu-Ser-Val-Ala-Gly-Leu-Pro-Gly-Lys-Lys
Purity	>97% (by HPLC)

CAT#	Product Name	Inquiry
R2002	Human PTHrP-(1-36)	Inquiry
R1365	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry
R1123	[Leu5]-Enkephalin	Inquiry
R1813	lypressin	Inquiry
R1939	NNMTi	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

Function of dynorphin (1-17) in analgesia

In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...

The Function of Dalbavancin in Acute Bacterial Skin and Skin Tissue Infections (ABSSSI)

Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...

Function of PMX-53 as an antagonists

PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...

What Is Anisomycin?

Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Storage	Store at -20°C.
Shipping Condition	Shipped at room temperature
InChI	InChI=1S/C68H122N20O18/c1-35(2)29-46(83-57(95)42-21-16-26-73-42)60(98)77-40(10)56(94)81-44(22-17-27-74-68(71)72)59(97)87-54(41(11)90)65(103)84-47(30-36(3)4)61(99)85-49(34-89)62(100)86-53(38(7)8)64(102)78-39(9)55(93)75-32-52(92)80-48(31-37(5)6)66(104)88-28-18-23-50(88)63(101)76-33-51(91)79-43(19-12-14-24-69)58(96)82-45(67(105)106)20-13-15-25-70/h35-50,53-54,73,89-90H,12-34,69-70H2,1-11H3,(H,75,93)(H,76,101)(H,77,98)(H,78,102)(H,79,91)(H,80,92)(H,81,94)(H,82,96)(H,83,95)(H,84,103)(H,85,99)(H,86,100)(H,87,97)(H,105,106)(H4,71,72,74)/t39-,40-,41+,42-,43-,44-,45-,46-,47-,48-,49-,50-,53-,54-/m0/s1
InChI Key	NKBRRWBNPNUBDD-TYKVATLISA-N
Canonical SMILES	CC(C)CC(C(=O)NC(C)C(=O)NC(CCCN=C(N)N)C(=O)NC(C(C)O)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(C(C)C)C(=O)NC(C)C(=O)NCC(=O)NC(CC(C)C)C(=O)N1CCCC1C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O)NC(=O)C2CCCN2
Isomeric SMILES	C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]2CCCN2)O