Keywords Search Google Search Search

Steroidogenesis-Activator Polypeptide

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	CR00033
CAS	108563-23-1
M.F/Formula	C₁₄₁H₂₂₆N₃₄O₅₁
M.W/Mr.	3213.54
Sequence	IVQPIISKLYGSGGPPPTGEEDTDEKKDEL
Areas of Interest	Cancer Research

CAT#	Product Name	Inquiry
CR00031	H-Tyr-Lys-OH	Inquiry
F0902	H-Cys-Val-2-Nal-Met-OH	Inquiry
G03006	Minigastrin I, human, HG-13	Inquiry
CR00032	Tumor Targeted Pro-Apoptotic Peptide	Inquiry
K04003	Kisspeptin-54 (27-54) (human)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The effect of thymopentin in the treatment of chronic severe viral hepatitis B

The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...

Function of dynorphin (1-17) in analgesia

In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

Palmitoyl pentapeptide: bioactive peptide for anti-aging and skin care

Palmitoyl Pentapeptide, a peptide with significant biological activity, has attracted attention for its anti-aging effect on ...

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: