CAT# | AF2495 |
Sequence | ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...
Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...