SARS-CoV-2 Spike RBD (receptor binding domain), 395-430-Lys(Biotin-LC)
SARS-CoV-2 Spike RBD (receptor binding domain), 395-430-Lys(Biotin-LC)
This peptide sequence represents residues 395-430 of the RBD (receptor binding domain) identified from the RefSeq (YP_009724390.1) from the spike protein of SARS-CoV-2. The sequence is labeled with Biotin-LC at the C-terminus.
Online Inquiry
| CAT# | S29018 |
| Sequence | One Letter Code: VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT-K(Biotin-LC)-NH2
Three-Letter Code: H-Val-Tyr-Ala-Asp-Ser-Phe-Val-Ile-Arg-Gly-Asp-Glu-Val-Arg-Gln-Ile-Ala-Pro-Gly-Gln-Thr-Gly-Lys-Ile-Ala-Asp-Tyr-Asn-Tyr-Lys-Leu-Pro-Asp-Asp-Phe-Thr-Lys(Biotin-LC)-NH2 |
| Purity | 95% |
| Size | 0.1 mg |
Storage | -20 °C |
References | 1. Wan Y, Shang J, et al. Receptor recognition by the novel coronavirus from Wuhan: an analysis based on decade-long structural studies of SARS coronavirus. J Virol. 2020 Mar 17;94(7). 2. Chen Y, et al. Structure analysis of the receptor binding of 2019-nCoV. Biochem Biophys Res Commun. 2020 Feb 17. |
Write a review
Ask a question
My Review for SARS-CoV-2 Spike RBD (receptor binding domain), 395-430-Lys(Biotin-LC)
Required fields are marked with *
×
Ask a Question for SARS-CoV-2 Spike RBD (receptor binding domain), 395-430-Lys(Biotin-LC)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
