S961
S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively.
Online Inquiry
| CAT# | R1841 |
| CAS | 1083433-49-1 |
| M.F/Formula | C211H297N55O71S2 |
| M.W/Mr. | 4804.13 |
| Sequence | One Letter Code: GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY
Three Letter Code: Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40) |
| Appearance | White to off-white lyophilized solid |
| Purity | >97% (by HPLC) |
| Activity | In vitro, S961 also shows high-affinity to Rat IR and Pig IR with IC50s of 0.056 nM and 0.084 nM in PEG-assay, respectively. |
| Storage | −20°C |
Solubility | Soluble in H2O |
Shipping Condition | Room temperature |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
