Psalmotoxin 1, a protein toxin from a tarantula, inhibits H+-gated acid-sensing ion channel (ASIC1a).
CAT# | R1646 |
Background | Psalmotoxin-1 (PcTx1), isolated from the venom of the tarantula Psalmopoeus cambridgei, was shown to antagonize the ASIC1a subtype9 with nanomolar affinity and increases the channels sensitivity to protons. >> Read More |
Synonyms/Alias | PcTx1; Psalmopoeus cambridgei toxin-1 |
M.F/Formula | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
M.W/Mr. | 4689.41 |
Sequence | One Letter Code: EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Arg28, Arg17-Ser33) three Letter Code: Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr(Disulfide bridge: Cys3-Cys18, Cys10-Arg28, Arg17-Ser33) |
Labeling Target | Acid-sensing ion channel 1a (ASIC1a) |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...