Preptin, Human Pro-Insulin Growth Factor II (96-129), human

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	I02009
M.W/Mr.	4029.5
Sequence	DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL

CAT#	Product Name	Inquiry
I02008	Preptin, Human Pro-Insulin Growth Factor II (67-100), mouse	Inquiry
P5802	Preptin (rat)	Inquiry
O1506	Osteocalcin (45-49) (human)	Inquiry
O03007	(Thr46)-Osteocalcin (45-49) (human)	Inquiry
O03006	(Glu13.17.20)-Osteocalcin (1-46) (mouse)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Mechanism of Acetyl Tetrapeptide-22

The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...

Function of spadin in neurological treatment of depression

Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...

The medical value of MCL 0020

MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...

Jingzhaotoxin-III, A Selective NaV1.5 Channel Blocker

Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...

What is PT-141?

PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal amide molecu ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: