Effective voltage-gated sodium channels blocker
(IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively) that blocks inward sodium currents in a voltage-dependent manner.
CAT# | R1061 |
CAS | 880886-00-0 |
M.F/Formula | C176H269N51O48S6 |
M.W/Mr. | 4059.74 |
Sequence | DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI(Modifications: Disulfide bridges: 2-17,9-23,16-30) |
Labeling Target | Sodium channels |
Appearance | White lyophilised solid |
Purity | >99% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...
GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...