CAT# | AF2946 |
Sequence | KYYGNGVHCGKKTCYVDWGQATASIGKIIVNGWTQHGPWAHR |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...
Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...