CAT# | AF3047 |
Sequence | YDTGIQGWTCGSRGLCRKHCYAQEHTVGYHGCPRRYRCCALRF |
Activity | Gram+ & Gram-, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...
Figure 1. Chemical structure of lysipressinLysipressin ([Lys8]-vasopressin) has been identified in the North Ame ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...