Keywords Search Google Search Search

Parathyroid Hormone (1-34), rat

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	P03053
M.F/Formula	C180H291N55O48S2
M.W/Mr.	4057.8
Sequence	One Letter Code: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF three Letter Code: H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH (trifluoroacetate salt)

CAT#	Product Name	Inquiry
P03022	pTH (1-31) amide (human)	Inquiry
P03003	Parathyroid Hormone (70-84), human	Inquiry
P03040	pTH-Related Protein (1-37) (human, mouse, rat)	Inquiry
P03056	[Nle8,18, Tyr34] Parathyroid Hormone (1-34), human	Inquiry
P03042	TIP-39	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Deslorelin Acetate in Advanced Prostate Cancer

Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

Function of dipeptide diaminobutyroyl benzylamide diacetate in skin

Dipeptide diaminobutyroyl benzylamide diacetate, often marketed under the name Syn-Ake, is a synthetic peptide that mimics th ...

Function of enfuvirtide in HIV-1 infection

Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...

Function of Histrelin Acetate in Prostate Cancer

Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Source#	Synthetic
Length	34
Storage	-20 ± 5 °C