Pancreatic Polypeptide, human
Pancreatic Polypeptide, human
Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.
Online Inquiry
| CAT# | R1600 |
| CAS | 75976-10-2 |
| Synonyms/Alias | Human pancreatic polypeptide |
| M.F/Formula | C₁₈₅H₂₈₇N₅₃O₅₄S₂ |
| M.W/Mr. | 4181.71 |
| Sequence | One Letter Code: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
three Letter Code: Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2 |
Write a review
Ask a question
My Review for Pancreatic Polypeptide, human
Required fields are marked with *
×
Ask a Question for Pancreatic Polypeptide, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
