PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
Online Inquiry
| CAT# | P08011 |
| M.F/Formula | C182H300N56O45S |
| M.W/Mr. | 4024.80 |
| Sequence | FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| P08008 |
PACAP-27 (human, mouse, ovine, porcine, rat) |
|
|
Inquiry |
| P08002 |
[Des-Gln16] PACAP (6-27), human, ovine, rat |
|
|
Inquiry |
| P08009 |
PACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat) |
|
|
Inquiry |
| P08004 |
[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat |
|
|
Inquiry |
| P08013 |
PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) |
|
|
Inquiry |
Write a review
Ask a question
My Review for PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
Required fields are marked with *
×
Ask a Question for PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
