CAT# | AF2125 |
Sequence | IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...