CAT# | AF2056 |
Sequence | RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC |
Activity | Antibacterial, Antifungal, Antiviral |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal amide molecu ...
GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...