Neuropeptide Y (29-64), amide, human TFA
Neuropeptide Y (29-64), amide, human TFA
Neuropeptide Y (29-64), amide, human (TFA) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.
Online Inquiry
| CAT# | R1546 |
| M.F/Formula | C₁₉₁H₂₈₆F₃N₅₅O₅₉S |
| M.W/Mr. | 4385.70 |
| Sequence | One Letter Code: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
three Letter Code: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
Write a review
Ask a question
My Review for Neuropeptide Y (29-64), amide, human TFA
Required fields are marked with *
×
Ask a Question for Neuropeptide Y (29-64), amide, human TFA
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
