Nesiritide
Nesiritide is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively.
Online Inquiry
| CAT# | R1530 |
| CAS | 124584-08-3 |
| Synonyms/Alias | Brain Natriuretic Peptide-32 human; BNP-32 |
| M.F/Formula | C₁₄₃H₂₄₄N₅₀O₄₂S₄ |
| M.W/Mr. | 3464.04 |
| Sequence | One Letter Code: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys10-Cys26)
three Letter Code: Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys10-Cys26) |
| Activity | Agonist |
| Biological Activity | Nesiritide, a recombinant human B-type natriuretic peptide, is the first in a new drug class for the treatment of decompensated heart failure. |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for Nesiritide
Required fields are marked with *
×
Ask a Question for Nesiritide
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
