CAT# | M20003 |
Sequence | YKRCHKKEGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVN |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...