A potent and specific KV1.3 channel blocker, and exhibits no effect at calcium-activated channels. Margatoxin can reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.
CAT# | R0995 |
CAS | 145808-47-5 |
Background | Margatoxin (MgTx) is a 39 amino-acid-long peptide stabilized by 3 disulfide bridges with a molecular weight of 4185, isolated from the venom of the scorpion Centruroides margaritatus. This peptide is widely used in the field of ion channel research. Margatoxin is considered as a high affinity and selective inhibitor of the Kv1.3 channel, however, a comprehensive study of its selectivity with electrophysiological methods has not been published yet. >> Read More |
Synonyms/Alias | MgTX |
M.F/Formula | C178H286N52O50S7 |
M.W/Mr. | 4178.96 |
Sequence | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bridge between Cys7 and Cys29, Cys13 and Cys34, Cys17 and Cys36) |
Labeling Target | KV1.3 channel |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...