A potent and specific KV1.3 channel blocker, and exhibits no effect at calcium-activated channels. Margatoxin can reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.
CAT# | R0995 |
CAS | 145808-47-5 |
Background | Margatoxin (MgTx) is a 39 amino-acid-long peptide stabilized by 3 disulfide bridges with a molecular weight of 4185, isolated from the venom of the scorpion Centruroides margaritatus. This peptide is widely used in the field of ion channel research. Margatoxin is considered as a high affinity and selective inhibitor of the Kv1.3 channel, however, a comprehensive study of its selectivity with electrophysiological methods has not been published yet. >> Read More |
Synonyms/Alias | MgTX |
M.F/Formula | C178H286N52O50S7 |
M.W/Mr. | 4178.96 |
Sequence | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bridge between Cys7 and Cys29, Cys13 and Cys34, Cys17 and Cys36) |
Labeling Target | KV1.3 channel |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Dipeptide diaminobutyroyl benzylamide diacetate, often marketed under the name Syn-Ake, is a synthetic peptide that mimics th ...
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...
The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...
The history of the discovery and research of GLP-1 (Glucagon like peptide-1) can be traced back to the late 60s to early 70s ...
Trifluoroacetyl tripeptide-2 (TFA-T2) is an innovative peptide compound that has garnered significant attention in dermatolog ...