CAT# | AF1964 |
Sequence | MKTILRFVAGYDIASHKKKTGGYPWERGKA |
Activity | Gram+, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...