CAT# | AF2705 |
Sequence | GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK |
Activity | Antibacterial, Antiparasitic |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Etomidate, a highly selective intravenous anesthetic agent, was first synthesized at Janssen Pharmaceuticals in ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...
Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...
GR 94800, is a linear heptapeptide with the structure of PhCO-Ala-Ala-D-Trp-Phe-D-Pro-Nle Amide, which is a high ...