Keywords Search Google Search Search

LL-37, reverse sequence

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	L07002
M.W/Mr.	4493.3
Sequence	SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

CAT#	Product Name	Inquiry
L07004	Cys-LC-LL-37	Inquiry
L07006	KR-12 (human)	Inquiry
L07005	Biotinyl-LL-37 amide	Inquiry
L07001	LL-37, Antimicrobial Peptide, human	Inquiry
L07008	LL-37 amide	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

The effect of Sincalide on gastric movement

Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...

Function of trifluoroacetyl tripeptide-2 in human skin

Trifluoroacetyl tripeptide-2 (TFA-T2) is an innovative peptide compound that has garnered significant attention in dermatolog ...

Myristoyl Octapeptide-1 promotes a healthy appearance of the skin

The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...

Function of NFAT inhibitor

NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: