LL-37 scrambled peptide
LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. Scrambled peptide is random permutation of the original peptide that can be used as negative control or screening tool in research.
Online Inquiry
| CAT# | R1486 |
| M.F/Formula | C205H340N60O53 |
| M.W/Mr. | 4493.30 |
| Sequence | One Letter Code: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Three Letter Code: Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg |
| Purity | ≥97% (HPLC) |
| Shipping Condition | +20°C (International: -20°C) |
Write a review
Ask a question
My Review for LL-37 scrambled peptide
Required fields are marked with *
×
Ask a Question for LL-37 scrambled peptide
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
