LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. Scrambled peptide is random permutation of the original peptide that can be used as negative control or screening tool in research.
CAT# | R1486 |
M.F/Formula | C205H340N60O53 |
M.W/Mr. | 4493.30 |
Sequence | One Letter Code: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR Three Letter Code: Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg |
Purity | ≥97% (HPLC) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
The peptide st-Ht31 P, A-kinase anchoring protein (AKAP) inhibitor, has the negative control for st-Ht31. In DRG ...
Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...