CAT# | L02001 |
M.F/Formula | C142H237N45O39S7 |
M.W/Mr. | 3423.19 |
Sequence | AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...