CAT# | AF2141 |
Sequence | QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...
Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...
Figure 1. Chemical structure of lysipressinLysipressin ([Lys8]-vasopressin) has been identified in the North Ame ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...