CAT# | A13299 |
M.W/Mr. | 4498.0 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLGVDGVVIA |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...